PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008591m
Common NameEUTSA_v10008591mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28550.4 Da    PI: 8.2857
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008591mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81.1e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Thhalv10008591m  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                     79***********************************************96 PP

2K-box94.91.3e-31911741598
            K-box  15 eslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       s+qqe+ kLk++++ Lqr+qR+llGedL++Ls keL++Le+qL++slk+iR+ +++++l+q+++lq ke++l e+nk+Lr +l
  Thhalv10008591m  91 LSSQQEYLKLKERYDALQRTQRNLLGEDLGPLSTKELESLERQLDSSLKQIRALRTQFMLDQLNDLQSKERMLTETNKTLRLRL 174
                      578*****************************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.515161IPR002100Transcription factor, MADS-box
CDDcd002653.08E-45276No hitNo description
SuperFamilySSF554551.57E-33275IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-333859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129715.190180IPR002487Transcription factor, K-box
PfamPF014861.7E-2592174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0048481Biological Processplant ovule development
GO:0048833Biological Processspecification of floral organ number
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCSS  60
SSMLRTLERY QKCNYGAPEP NVPSREALAE LSSQQEYLKL KERYDALQRT QRNLLGEDLG  120
PLSTKELESL ERQLDSSLKQ IRALRTQFML DQLNDLQSKE RMLTETNKTL RLRLADGYQM  180
PLQLNPNQED VDYGRHQQQH SQAFFQPLEC EPILQIGYQG QQDHGMGAGP SVNNYMLGWL  240
PYDTNSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D4e-64751771104Developmental protein SEPALLATA 3
4ox0_C4e-64751771104Developmental protein SEPALLATA 3
4ox0_B4e-64751771104Developmental protein SEPALLATA 3
4ox0_A4e-64751771104Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00605ChIP-seqTransfer from AT1G24260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0882720.0AY088272.1 Arabidopsis thaliana clone 5055 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415783.10.0hypothetical protein EUTSA_v10008591mg
SwissprotO040671e-170AGL9_SINAL; Agamous-like MADS-box protein AGL9 homolog
SwissprotO224561e-170SEP3_ARATH; Developmental protein SEPALLATA 3
TrEMBLV4MQZ00.0V4MQZ0_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2877__AT1G24260.11e-171(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62202644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G24260.11e-173MIKC_MADS family protein